TREH polyclonal antibody
  • TREH polyclonal antibody

TREH polyclonal antibody

Ref: AB-PAB23459
TREH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TREH.
Información adicional
Size 100 uL
Gene Name TREH
Gene Alias MGC129621|TRE|TREA
Gene Description trehalase (brush-border membrane glycoprotein)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LYQDDKQFVDMPLSIAPEQVLQTFTELSRDHNHSIPREQLQAFVHEHFQAKGQELQPWTPADWKDSPQFLQKISDAKLRAWAGQLHQLWKKLGKK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TREH.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11181
Iso type IgG

Enviar uma mensagem


TREH polyclonal antibody

TREH polyclonal antibody