WWC3 polyclonal antibody
  • WWC3 polyclonal antibody

WWC3 polyclonal antibody

Ref: AB-PAB23452
WWC3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WWC3.
Información adicional
Size 100 uL
Gene Name WWC3
Gene Alias BM042|KIAA1280
Gene Description WWC family member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KRLERRARRISACLSDYSLASDSGVFEPLTKRNEDAEEPAYGDTASNGDPQIHVGLLRDSGSECLLVHVLQLKNPAGLAVKEDCKVHIRVYLPPLDSGT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WWC3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55841
Iso type IgG

Enviar uma mensagem


WWC3 polyclonal antibody

WWC3 polyclonal antibody