UFM1 polyclonal antibody
  • UFM1 polyclonal antibody

UFM1 polyclonal antibody

Ref: AB-PAB23448
UFM1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UFM1.
Información adicional
Size 100 uL
Gene Name UFM1
Gene Alias BM-002|C13orf20|bA131P10.1
Gene Description ubiquitin-fold modifier 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IRAFPTTTPRSLHLFTSSTFLARALPGAFPTGACEERLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UFM1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51569
Iso type IgG

Enviar uma mensagem


UFM1 polyclonal antibody

UFM1 polyclonal antibody