OLFML1 polyclonal antibody
  • OLFML1 polyclonal antibody

OLFML1 polyclonal antibody

Ref: AB-PAB23446
OLFML1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OLFML1.
Información adicional
Size 100 uL
Gene Name OLFML1
Gene Alias UNQ564
Gene Description olfactomedin-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq QDPAMVHYIYQRFRVLEQGLEKCTQATRAYIQEFQEFSKNISVMLGRCQTYTSEYKSAVGNLALRVERAQRE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OLFML1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283298
Iso type IgG

Enviar uma mensagem


OLFML1 polyclonal antibody

OLFML1 polyclonal antibody