LOC57228 polyclonal antibody
  • LOC57228 polyclonal antibody

LOC57228 polyclonal antibody

Ref: AB-PAB23444
LOC57228 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LOC57228.
Información adicional
Size 100 uL
Gene Name LOC57228
Gene Alias MGC149453|MGC149454
Gene Description small trans-membrane and glycosylated protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq YKNKGSYVTYEPTEGEPSAIVQMESDLAKGSEKEEYFI
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LOC57228.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57228
Iso type IgG

Enviar uma mensagem


LOC57228 polyclonal antibody

LOC57228 polyclonal antibody