PARPBP polyclonal antibody
  • PARPBP polyclonal antibody

PARPBP polyclonal antibody

Ref: AB-PAB23441
PARPBP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PARPBP.
Información adicional
Size 100 uL
Gene Name PARPBP
Gene Alias AROM|C12orf48|PARI
Gene Description PARP1 binding protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RALTSNCENYNTVSPSQLLDFLSGKQYAVGDETDLSIPTSPTSKYNRDNEKVQLLARKIIFSYLNLLVNSKNDLAVA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PARPBP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55010
Iso type IgG

Enviar uma mensagem


PARPBP polyclonal antibody

PARPBP polyclonal antibody