PDS5B polyclonal antibody
  • PDS5B polyclonal antibody

PDS5B polyclonal antibody

Ref: AB-PAB23432
PDS5B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PDS5B.
Información adicional
Size 100 uL
Gene Name PDS5B
Gene Alias APRIN|AS3|CG008|FLJ23236|KIAA0979|RP1-267P19.1
Gene Description PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq ESPESSAIESTQSTPQKGRGRPSKTPSPSQPKKNVRVGRSKQAATKENDSSEEVDVFQGSSPVDDIPQEETEEEEVSTVNVRRRSAKRER
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PDS5B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23047
Iso type IgG

Enviar uma mensagem


PDS5B polyclonal antibody

PDS5B polyclonal antibody