ANKRD13A polyclonal antibody
  • ANKRD13A polyclonal antibody

ANKRD13A polyclonal antibody

Ref: AB-PAB23431
ANKRD13A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD13A.
Información adicional
Size 100 uL
Gene Name ANKRD13A
Gene Alias ANKRD13|NY-REN-25
Gene Description ankyrin repeat domain 13A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FGNVNGCSTAEESVSQNVEGTQADSASHITNFEVDQSVFEIPESYYVQDNGRNVHLQDEDYEIMQFAI
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD13A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 88455
Iso type IgG

Enviar uma mensagem


ANKRD13A polyclonal antibody

ANKRD13A polyclonal antibody