TEX9 polyclonal antibody
  • TEX9 polyclonal antibody

TEX9 polyclonal antibody

Ref: AB-PAB23426
TEX9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TEX9.
Información adicional
Size 100 uL
Gene Name TEX9
Gene Alias MGC40181
Gene Description testis expressed 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq QEELDNVVCECNKKEDEIQNLKSQVKNFEEDFMRQQRTINMQQSQVEKYKTLFEEANKKYDGLQQQLSSVERELENKRRLQKQAASSQSAT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TEX9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 374618
Iso type IgG

Enviar uma mensagem


TEX9 polyclonal antibody

TEX9 polyclonal antibody