CDAN1 polyclonal antibody
  • CDAN1 polyclonal antibody

CDAN1 polyclonal antibody

Ref: AB-PAB23425
CDAN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CDAN1.
Información adicional
Size 100 uL
Gene Name CDAN1
Gene Alias CDA-I|CDA1|CDAI|DLT|PRO1295|codanin
Gene Description congenital dyserythropoietic anemia, type I
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NCVKHIKATLVADLVRQAESLLQEQLVTQGEEGGDPAQLLEILCSQLCPHGAQALALGREFCQRKSPGAVRALLPEETPAAVLSSAENIAVGLA
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CDAN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 146059
Iso type IgG

Enviar uma mensagem


CDAN1 polyclonal antibody

CDAN1 polyclonal antibody