ERP29 polyclonal antibody
  • ERP29 polyclonal antibody

ERP29 polyclonal antibody

Ref: AB-PAB23419
ERP29 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ERP29.
Información adicional
Size 100 uL
Gene Name ERP29
Gene Alias C12orf8|ERp28|ERp31|PDI-DB
Gene Description endoplasmic reticulum protein 29
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ERP29.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10961
Iso type IgG

Enviar uma mensagem


ERP29 polyclonal antibody

ERP29 polyclonal antibody