C11orf86 polyclonal antibody
  • C11orf86 polyclonal antibody

C11orf86 polyclonal antibody

Ref: AB-PAB23415
C11orf86 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C11orf86.
Información adicional
Size 100 uL
Gene Name C11orf86
Gene Alias FLJ22675
Gene Description chromosome 11 open reading frame 86
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GTGLRSQSLREPRPSYGKLQEPWGRPQEGQLRRALSLRQGQEKSRSQGLERGTEGPDATAQE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C11orf86.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 254439
Iso type IgG

Enviar uma mensagem


C11orf86 polyclonal antibody

C11orf86 polyclonal antibody