DEPDC4 polyclonal antibody
  • DEPDC4 polyclonal antibody

DEPDC4 polyclonal antibody

Ref: AB-PAB23413
DEPDC4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DEPDC4.
Información adicional
Size 100 uL
Gene Name DEPDC4
Gene Alias DEP.4|FLJ33505
Gene Description DEP domain containing 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RRTGVHLCQVLMNHKVFEPVGMKKLFKKEKELEFEDSNISLYRFLGNKSSYDCCKRQKDAENEFNETLRPGYEMISNPLAQEIG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DEPDC4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 120863
Iso type IgG

Enviar uma mensagem


DEPDC4 polyclonal antibody

DEPDC4 polyclonal antibody