PEX5 polyclonal antibody
  • PEX5 polyclonal antibody

PEX5 polyclonal antibody

Ref: AB-PAB23410
PEX5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PEX5.
Información adicional
Size 100 uL
Gene Name PEX5
Gene Alias FLJ50634|FLJ50721|FLJ51948|PTS1-BP|PTS1R|PXR1
Gene Description peroxisomal biogenesis factor 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq DAVDVTQDYNETDWSQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTATDRWYDEYHPEEDLQHTASDFVAKVDDPKLA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PEX5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5830
Iso type IgG

Enviar uma mensagem


PEX5 polyclonal antibody

PEX5 polyclonal antibody