LRRC18 polyclonal antibody
  • LRRC18 polyclonal antibody

LRRC18 polyclonal antibody

Ref: AB-PAB23408
LRRC18 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC18.
Información adicional
Size 100 uL
Gene Name LRRC18
Gene Alias MGC34773|UNQ933|UNQ9338|VKGE9338
Gene Description leucine rich repeat containing 18
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq IFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC18.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 474354
Iso type IgG

Enviar uma mensagem


LRRC18 polyclonal antibody

LRRC18 polyclonal antibody