TMEM39A polyclonal antibody
  • TMEM39A polyclonal antibody

TMEM39A polyclonal antibody

Ref: AB-PAB23400
TMEM39A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM39A.
Información adicional
Size 100 uL
Gene Name TMEM39A
Gene Alias FLJ10902
Gene Description transmembrane protein 39A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq HQDSRAHLLLTDYNYVVQHEAVEESASTVGGLAKSKDFLSLLLESLKEQFNNATPIPTHSCPLSPDLIRNEVECLKADFNHRIK
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM39A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55254
Iso type IgG

Enviar uma mensagem


TMEM39A polyclonal antibody

TMEM39A polyclonal antibody