SCPEP1 polyclonal antibody
  • SCPEP1 polyclonal antibody

SCPEP1 polyclonal antibody

Ref: AB-PAB23396
SCPEP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCPEP1.
Información adicional
Size 100 uL
Gene Name SCPEP1
Gene Alias HSCP1|RISC
Gene Description serine carboxypeptidase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KPVISIVDELLEAGINVTVYNGQLDLIVDTMGQEAWVRKLKWPELPKFSQLKWKALYSDPKSLETSAFVKSYKNLAFYWILKAGHMVPSDQGDMALKMMRLVTQQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCPEP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 59342
Iso type IgG

Enviar uma mensagem


SCPEP1 polyclonal antibody

SCPEP1 polyclonal antibody