ACRBP polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant ACRBP.

AB-PAB23393

New product

ACRBP polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name ACRBP
Gene Alias FLJ51160|OY-TES-1|SP32
Gene Description acrosin binding protein
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq AQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLRATHGCRNPTLVQLDQYENHGLVPDGAVCSNLPYASWFESFCQFTHYRCS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ACRBP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84519
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant ACRBP.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant ACRBP.

Rabbit polyclonal antibody raised against recombinant ACRBP.