PPP1R32 polyclonal antibody
  • PPP1R32 polyclonal antibody

PPP1R32 polyclonal antibody

Ref: AB-PAB23392
PPP1R32 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPP1R32.
Información adicional
Size 100 uL
Gene Name PPP1R32
Gene Alias C11orf66|IIIG9
Gene Description protein phosphatase 1, regulatory subunit 32
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TSSGYGREKPSAGPPTKEVRKVHFDTQEHGPQAITGLEPREVPLLHQQQGQDPLERENFRHGPRFMTSEYNSKYLRDPLDQPDFLQKKSIGAKEGSGFTKQSHQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPP1R32.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 220004
Iso type IgG

Enviar uma mensagem


PPP1R32 polyclonal antibody

PPP1R32 polyclonal antibody