MAP1A polyclonal antibody
  • MAP1A polyclonal antibody

MAP1A polyclonal antibody

Ref: AB-PAB23390
MAP1A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MAP1A.
Información adicional
Size 100 uL
Gene Name MAP1A
Gene Alias FLJ77111|MAP1L|MTAP1A
Gene Description microtubule-associated protein 1A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SSFSHSTPSGNGKYLPGAITSPDEHILTPDSSFSKSPESLPGPALEDIAIKWEDKVPGLKDRTSEQKKEPEPKDEVLQQKD
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAP1A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4130
Iso type IgG

Enviar uma mensagem


MAP1A polyclonal antibody

MAP1A polyclonal antibody