CHCHD1 polyclonal antibody
  • CHCHD1 polyclonal antibody

CHCHD1 polyclonal antibody

Ref: AB-PAB23385
CHCHD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CHCHD1.
Información adicional
Size 100 uL
Gene Name CHCHD1
Gene Alias C10orf34|C2360|FLJ25854
Gene Description coiled-coil-helix-coiled-coil-helix domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQN
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CHCHD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 118487
Iso type IgG

Enviar uma mensagem


CHCHD1 polyclonal antibody

CHCHD1 polyclonal antibody