IPO4 polyclonal antibody
  • IPO4 polyclonal antibody

IPO4 polyclonal antibody

Ref: AB-PAB23384
IPO4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IPO4.
Información adicional
Size 100 uL
Gene Name IPO4
Gene Alias FLJ23338|Imp4|MGC131665
Gene Description importin 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AFLPYMESVFEEVFKLLECPHLNVRKAAHEALGQFCCALHKACQSCPSEPNTAALQAALARVVPSYMQAVNRERERQVVMAVLE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IPO4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79711
Iso type IgG

Enviar uma mensagem


IPO4 polyclonal antibody

IPO4 polyclonal antibody