PATL1 polyclonal antibody
  • PATL1 polyclonal antibody

PATL1 polyclonal antibody

Ref: AB-PAB23383
PATL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PATL1.
Información adicional
Size 100 uL
Gene Name PATL1
Gene Alias FLJ36874|MGC125671|MGC125672
Gene Description protein associated with topoisomerase II homolog 1 (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq QHRRLLHQRQQQNRSQHRNLNGAGDRGSHRSSHQDHLRKDPYANLMLQREKDWVSKIQMMQLQSTDPYLDDFYYQNYFEKLEKLSAAEEIQGDGPKKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PATL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 219988
Iso type IgG

Enviar uma mensagem


PATL1 polyclonal antibody

PATL1 polyclonal antibody