DYNC2H1 polyclonal antibody
  • DYNC2H1 polyclonal antibody

DYNC2H1 polyclonal antibody

Ref: AB-PAB23381
DYNC2H1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DYNC2H1.
Información adicional
Size 100 uL
Gene Name DYNC2H1
Gene Alias DHC1b|DHC2|DNCH2|DYH1B|FLJ11756|hdhc11
Gene Description dynein, cytoplasmic 2, heavy chain 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DVFNQRNKKSIFPYSVSLPQSCSILDYRAVIEKIPEDDKPSFFGLPANIARSSQRMISSQVISQLRILGRSITAGSKFDREIWSNELSPVLNLWKKLN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DYNC2H1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79659
Iso type IgG

Enviar uma mensagem


DYNC2H1 polyclonal antibody

DYNC2H1 polyclonal antibody