FDXACB1 polyclonal antibody
  • FDXACB1 polyclonal antibody

FDXACB1 polyclonal antibody

Ref: AB-PAB23380
FDXACB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FDXACB1.
Información adicional
Size 100 uL
Gene Name FDXACB1
Gene Alias -
Gene Description ferredoxin-fold anticodon binding domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HPIKTINEKLIAELGKVFPLKRLKCSYPLLPQEGTSVLPFWNCDFLSAAFWISLHEDNSNSESLTGGTSQDVEDFLVSFSELSLLKNPGRDGKEEACEGTCG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FDXACB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91893
Iso type IgG

Enviar uma mensagem


FDXACB1 polyclonal antibody

FDXACB1 polyclonal antibody