SAAL1 polyclonal antibody
  • SAAL1 polyclonal antibody

SAAL1 polyclonal antibody

Ref: AB-PAB23379
SAAL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SAAL1.
Información adicional
Size 100 uL
Gene Name SAAL1
Gene Alias FLJ41463
Gene Description serum amyloid A-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IGSTVYSKHWLFGVLSGLIQIVSPENTKSSSDDEEQLTELDEEMENEICRVWDMSMDEDVALFLQEFNAPDIFMGVLAKSKCPRLR
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SAAL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 113174
Iso type IgG

Enviar uma mensagem


SAAL1 polyclonal antibody

SAAL1 polyclonal antibody