RNF44 polyclonal antibody
  • RNF44 polyclonal antibody

RNF44 polyclonal antibody

Ref: AB-PAB23378
RNF44 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RNF44.
Información adicional
Size 100 uL
Gene Name RNF44
Gene Alias KIAA1100
Gene Description ring finger protein 44
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MRPWALAVTRWPPSAPVGQRRFSAGPGSTPGQLWGSPGLEGPLASPPARDERLPSQQPPSRPPHLPVEERRASAPAGGSPRMLHPATQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RNF44.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22838
Iso type IgG

Enviar uma mensagem


RNF44 polyclonal antibody

RNF44 polyclonal antibody