N4BP2L1 polyclonal antibody
  • N4BP2L1 polyclonal antibody

N4BP2L1 polyclonal antibody

Ref: AB-PAB23375
N4BP2L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant N4BP2L1.
Información adicional
Size 100 uL
Gene Name N4BP2L1
Gene Alias CG018
Gene Description NEDD4 binding protein 2-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq KIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNNARYWNSYTEFPNRRAHGGFTNESSYHRRG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human N4BP2L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90634
Iso type IgG

Enviar uma mensagem


N4BP2L1 polyclonal antibody

N4BP2L1 polyclonal antibody