KIAA1704 polyclonal antibody
  • KIAA1704 polyclonal antibody

KIAA1704 polyclonal antibody

Ref: AB-PAB23373
KIAA1704 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1704.
Información adicional
Size 100 uL
Gene Name KIAA1704
Gene Alias AD029|LSR7|RP11-245H20.2|bA245H20.2
Gene Description KIAA1704
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KLTKGDDDSSKPIVRESWMTELPPEMKDFGLGPRTFKRRADDTSGDRSIWTDTPADRERKAKETQEARKSSSKKDEEHILSGRD
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA1704.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55425
Iso type IgG

Enviar uma mensagem


KIAA1704 polyclonal antibody

KIAA1704 polyclonal antibody