ANO6 polyclonal antibody
  • ANO6 polyclonal antibody

ANO6 polyclonal antibody

Ref: AB-PAB23371
ANO6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANO6.
Información adicional
Size 100 uL
Gene Name ANO6
Gene Alias MGC104751|TMEM16F
Gene Description anoctamin 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EEDDDDGDIVLENLGQTIVPDLGSLESQHDFRTPEFEEFNGKPDSLFFNDGQRRIDFVLVYEDESRKETNKKGTNEKQRRKRQAYESNLICHGLQLEATRSVLD
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANO6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 196527
Iso type IgG

Enviar uma mensagem


ANO6 polyclonal antibody

ANO6 polyclonal antibody