MBD6 polyclonal antibody
  • MBD6 polyclonal antibody

MBD6 polyclonal antibody

Ref: AB-PAB23369
MBD6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MBD6.
Información adicional
Size 100 uL
Gene Name MBD6
Gene Alias KIAA1887
Gene Description methyl-CpG binding domain protein 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq MERSPRRTHHWQHNGELAEGGAEPKDPPPPGPHSEDLKVPPGVVRKSRRGRRRKYNPTRNSNSSRQDITLEPSPTARAA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MBD6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 114785
Iso type IgG

Enviar uma mensagem


MBD6 polyclonal antibody

MBD6 polyclonal antibody