MCF2L2 polyclonal antibody
  • MCF2L2 polyclonal antibody

MCF2L2 polyclonal antibody

Ref: AB-PAB23367
MCF2L2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MCF2L2.
Información adicional
Size 100 uL
Gene Name MCF2L2
Gene Alias DKFZp686K0690|FLJ42509|KIAA0861
Gene Description MCF.2 cell line derived transforming sequence-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EMSTSKGSGAGSGPWIKNMERATTSKEDPASSTGGIKGCSSREFSSTDTFEDCEGAEDMEKESSALSLAGLFQSDDSHETCSSKSAFLERGESSQGE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MCF2L2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23101
Iso type IgG

Enviar uma mensagem


MCF2L2 polyclonal antibody

MCF2L2 polyclonal antibody