PACS1 polyclonal antibody
  • PACS1 polyclonal antibody

PACS1 polyclonal antibody

Ref: AB-PAB23363
PACS1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PACS1.
Información adicional
Size 100 uL
Gene Name PACS1
Gene Alias FLJ10209|KIAA1175
Gene Description phosphofurin acidic cluster sorting protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DTTSPMELAALEKIKSTWIKNQDDSLTETDTLEITDQDMFGDASTSLVVPEKVKTPMKSSKTDLQGSASPSKVEGVHTPRQKRSTPLKERQLSKPLSE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PACS1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55690
Iso type IgG

Enviar uma mensagem


PACS1 polyclonal antibody

PACS1 polyclonal antibody