FAM48A polyclonal antibody
  • FAM48A polyclonal antibody

FAM48A polyclonal antibody

Ref: AB-PAB23361
FAM48A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM48A.
Información adicional
Size 100 uL
Gene Name FAM48A
Gene Alias C13|C13orf19|FP757|P38IP|bA421P11.4
Gene Description family with sequence similarity 48, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RSPCNLAIPSEVDVEKYAKVEKSIKSDDSQPTVWPAHDVKDDYVFECEAGTQYQKTKLTILQSLGDPLYYGKIQPCKADEESDSQMSPSHSSTDD
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM48A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55578
Iso type IgG

Enviar uma mensagem


FAM48A polyclonal antibody

FAM48A polyclonal antibody