CCDC77 polyclonal antibody
  • CCDC77 polyclonal antibody

CCDC77 polyclonal antibody

Ref: AB-PAB23354
CCDC77 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC77.
Información adicional
Size 100 uL
Gene Name CCDC77
Gene Alias MGC13183
Gene Description coiled-coil domain containing 77
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq IMTKRYEALERRRILEVEGFKTDIKVLRQKLKDLEQMLYKATVNARANQDLALLCEVRDSNRRAHKIQGELKNLKSKVFGLENEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC77.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84318
Iso type IgG

Enviar uma mensagem


CCDC77 polyclonal antibody

CCDC77 polyclonal antibody