SLC39A8 polyclonal antibody
  • SLC39A8 polyclonal antibody

SLC39A8 polyclonal antibody

Ref: AB-PAB23353
SLC39A8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC39A8.
Información adicional
Size 100 uL
Gene Name SLC39A8
Gene Alias BIGM103|LZT-Hs6|PP3105|ZIP8
Gene Description solute carrier family 39 (zinc transporter), member 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHKTRPSHS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC39A8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64116
Iso type IgG

Enviar uma mensagem


SLC39A8 polyclonal antibody

SLC39A8 polyclonal antibody