ARHGAP44 polyclonal antibody
  • ARHGAP44 polyclonal antibody

ARHGAP44 polyclonal antibody

Ref: AB-PAB23351
ARHGAP44 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARHGAP44.
Información adicional
Size 100 uL
Gene Name ARHGAP44
Gene Alias KIAA0672|NPC-A-10
Gene Description Rho-type GTPase-activating protein RICH2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq STPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMSTDLVHFDIPSIHIELGSTLRLSPLEHMRRHSVTDKRDSE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARHGAP44.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9912
Iso type IgG

Enviar uma mensagem


ARHGAP44 polyclonal antibody

ARHGAP44 polyclonal antibody