PHF8 polyclonal antibody
  • PHF8 polyclonal antibody

PHF8 polyclonal antibody

Ref: AB-PAB23348
PHF8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PHF8.
Información adicional
Size 100 uL
Gene Name PHF8
Gene Alias DKFZp686E0868|JHDM1F|KIAA1111|MRXSSD|ZNF422
Gene Description PHD finger protein 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ASPSTQEAIQGMLCMANLQSSSSSPATSSLQAWWTGGQDRSSGSSSSGLGTVSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDSLGACFKDAEYIYPSLESDD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PHF8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23133
Iso type IgG

Enviar uma mensagem


PHF8 polyclonal antibody

PHF8 polyclonal antibody