TTC36 polyclonal antibody
  • TTC36 polyclonal antibody

TTC36 polyclonal antibody

Ref: AB-PAB23339
TTC36 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TTC36.
Información adicional
Size 100 uL
Gene Name TTC36
Gene Alias HBP21
Gene Description tetratricopeptide repeat domain 36
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GTPNDQAVLQAIFNPDTPFGDIVGLDLGEEAEKEEREEDEVFPQAQLEQSKALELQGVMAAEA
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (0.4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TTC36.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 143941
Iso type IgG

Enviar uma mensagem


TTC36 polyclonal antibody

TTC36 polyclonal antibody