LRRC56 polyclonal antibody
  • LRRC56 polyclonal antibody

LRRC56 polyclonal antibody

Ref: AB-PAB23338
LRRC56 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC56.
Información adicional
Size 100 uL
Gene Name LRRC56
Gene Alias DKFZp761L1518|FLJ00101
Gene Description leucine rich repeat containing 56
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HNPCPQSKGPGSQRDRLGEQLVEEYLSPARLQALARVDDLRLVRTLEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWLARCGLADLDGI
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC56.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 115399
Iso type IgG

Enviar uma mensagem


LRRC56 polyclonal antibody

LRRC56 polyclonal antibody