C12orf45 polyclonal antibody
  • C12orf45 polyclonal antibody

C12orf45 polyclonal antibody

Ref: AB-PAB23336
C12orf45 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C12orf45.
Información adicional
Size 100 uL
Gene Name C12orf45
Gene Alias MGC40397
Gene Description chromosome 12 open reading frame 45
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LINSQPKSRKTSTLQTVRIERSPLLDQVQTFLPQMARANEKLRKEMAAAPPGRFNIENIDGPHSKVIQMDVALFEMNQSDSKEVD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C12orf45.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 121053
Iso type IgG

Enviar uma mensagem


C12orf45 polyclonal antibody

C12orf45 polyclonal antibody