PRAP1 polyclonal antibody
  • PRAP1 polyclonal antibody

PRAP1 polyclonal antibody

Ref: AB-PAB23334
PRAP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRAP1.
Información adicional
Size 100 uL
Gene Name PRAP1
Gene Alias MGC126792|PRO1195|RP11-122K13.6|UPA
Gene Description proline-rich acidic protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYH
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PRAP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 118471
Iso type IgG

Enviar uma mensagem


PRAP1 polyclonal antibody

PRAP1 polyclonal antibody