MSANTD2 polyclonal antibody
  • MSANTD2 polyclonal antibody

MSANTD2 polyclonal antibody

Ref: AB-PAB23330
MSANTD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MSANTD2.
Información adicional
Size 100 uL
Gene Name MSANTD2
Gene Alias C11orf61
Gene Description Myb/SANT-like DNA-binding domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ETNALIAVWGNERLVEARYQQLEGAGTVFGSKAPGPAMYERVSRALAELGYERTPSQCRERIKTLRRCYSRVKEHGVGKRKSSYTFEQLEQVFGQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MSANTD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79684
Iso type IgG

Enviar uma mensagem


MSANTD2 polyclonal antibody

MSANTD2 polyclonal antibody