C10orf90 polyclonal antibody
  • C10orf90 polyclonal antibody

C10orf90 polyclonal antibody

Ref: AB-PAB23323
C10orf90 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C10orf90.
Información adicional
Size 100 uL
Gene Name C10orf90
Gene Alias FLJ32938|bA422P15.2
Gene Description chromosome 10 open reading frame 90
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq AEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C10orf90.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 118611
Iso type IgG

Enviar uma mensagem


C10orf90 polyclonal antibody

C10orf90 polyclonal antibody