SPATS2 polyclonal antibody
  • SPATS2 polyclonal antibody

SPATS2 polyclonal antibody

Ref: AB-PAB23321
SPATS2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPATS2.
Información adicional
Size 100 uL
Gene Name SPATS2
Gene Alias FLJ13117|Nbla00526|P59SCR|SCR59|SPATA10
Gene Description spermatogenesis associated, serine-rich 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SKSVSIQEEQSAPSSEKGGMNGYHVNGAINDTESVDSLSEGLETLSIDARELEDPESAMLDTLDRTGSMLQNGVSDFETKSLTMHSIHNSQQPRNAAKSLSRPTTETQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPATS2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 65244
Iso type IgG

Enviar uma mensagem


SPATS2 polyclonal antibody

SPATS2 polyclonal antibody