CXorf56 polyclonal antibody
  • CXorf56 polyclonal antibody

CXorf56 polyclonal antibody

Ref: AB-PAB23317
CXorf56 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CXorf56.
Información adicional
Size 100 uL
Gene Name CXorf56
Gene Alias FLJ22965
Gene Description chromosome X open reading frame 56
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq RRPEGIERQYRKKCAKCGLPLFYQSQPKNAPVTFIVDGAVVKFGQGFGKTNIYTQKQEPPKKVMMTKRTKD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CXorf56.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 63932
Iso type IgG

Enviar uma mensagem


CXorf56 polyclonal antibody

CXorf56 polyclonal antibody