PLEKHA7 polyclonal antibody
  • PLEKHA7 polyclonal antibody

PLEKHA7 polyclonal antibody

Ref: AB-PAB23315
PLEKHA7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLEKHA7.
Información adicional
Size 100 uL
Gene Name PLEKHA7
Gene Alias DKFZp686M22243
Gene Description pleckstrin homology domain containing, family A member 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq SSLKRDMEKVERQAVPQANHTESCHECGRVGPGHTRDCPHRGHDDIVNFERQEQEGEQYRSQRDPLEGKRDRSKARSPYSPAEEDALFMDLPTGP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLEKHA7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 144100
Iso type IgG

Enviar uma mensagem


PLEKHA7 polyclonal antibody

PLEKHA7 polyclonal antibody