PRPF40B polyclonal antibody
  • PRPF40B polyclonal antibody

PRPF40B polyclonal antibody

Ref: AB-PAB23313
PRPF40B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRPF40B.
Información adicional
Size 100 uL
Gene Name PRPF40B
Gene Alias HYPC
Gene Description PRP40 pre-mRNA processing factor 40 homolog B (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PQPQPDPPPVPPGPTPVPTGLLEPEPGGSEDCDVLEATQPLEQGFLQQLEEGPSSSGQHQPQQEEEESKPEPERSGLSWSNREKAKQAF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PRPF40B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25766
Iso type IgG

Enviar uma mensagem


PRPF40B polyclonal antibody

PRPF40B polyclonal antibody