KIAA1731 polyclonal antibody
  • KIAA1731 polyclonal antibody

KIAA1731 polyclonal antibody

Ref: AB-PAB23312
KIAA1731 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1731.
Información adicional
Size 100 uL
Gene Name KIAA1731
Gene Alias FLJ40913
Gene Description KIAA1731
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LRVSISREQSFFGSPLAHDPFSCLQLVGQENVCGDDYDEAVKLKESVVENHAVLSYAVEEEHAYLGPTVKPDDKAKTLSYEPLSSATVSTGSLLSYENTDLS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA1731.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 85459
Iso type IgG

Enviar uma mensagem


KIAA1731 polyclonal antibody

KIAA1731 polyclonal antibody