TBCEL polyclonal antibody
  • TBCEL polyclonal antibody

TBCEL polyclonal antibody

Ref: AB-PAB23311
TBCEL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TBCEL.
Información adicional
Size 100 uL
Gene Name TBCEL
Gene Alias El|FLJ14177|LRRC35|MGC10233
Gene Description tubulin folding cofactor E-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVP
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TBCEL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 219899
Iso type IgG

Enviar uma mensagem


TBCEL polyclonal antibody

TBCEL polyclonal antibody